Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Bruton's tyrosine kinase [50068] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries) |
Domain d1qlya_: 1qly A: [24530] |
PDB Entry: 1qly (more details)
SCOPe Domain Sequences for d1qlya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlya_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} lkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvteae
Timeline for d1qlya_: