Lineage for d1qlya_ (1qly A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782935Protein Bruton's tyrosine kinase [50068] (1 species)
  7. 2782936Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)
  8. 2782939Domain d1qlya_: 1qly A: [24530]

Details for d1qlya_

PDB Entry: 1qly (more details)

PDB Description: nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d1qlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlya_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
lkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvteae

SCOPe Domain Coordinates for d1qlya_:

Click to download the PDB-style file with coordinates for d1qlya_.
(The format of our PDB-style files is described here.)

Timeline for d1qlya_: