Lineage for d1aww__ (1aww -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109388Protein Bruton's tyrosine kinase [50068] (1 species)
  7. 109389Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)
  8. 109391Domain d1aww__: 1aww - [24529]

Details for d1aww__

PDB Entry: 1aww (more details)

PDB Description: sh3 domain from bruton's tyrosine kinase, nmr, 42 structures

SCOP Domain Sequences for d1aww__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aww__ b.34.2.1 (-) Bruton's tyrosine kinase {Human (Homo sapiens)}
gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
vteaeds

SCOP Domain Coordinates for d1aww__:

Click to download the PDB-style file with coordinates for d1aww__.
(The format of our PDB-style files is described here.)

Timeline for d1aww__: