SCOPe 2.08: Domain d1awwa1: 1aww A:4-67

Lineage for d1awwa1 (1aww A:4-67)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Bruton's tyrosine kinase [50068] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)

8. Domain d1awwa1: 1aww A:4-67 [24529]
   Other proteins in same PDB: d1awwa2

Details for d1awwa1

PDB Entry: 1aww

PDB Description: sh3 domain from bruton's tyrosine kinase, nmr, 42 structures

PDB Compounds: (A:) bruton's tyrosine kinase

SCOPe Domain Sequences for d1awwa1:

Sequence; same for both SEQRES and ATOM records:

>d1awwa1 b.34.2.1 (A:4-67) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
stselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvte
aeds

Timeline for d1awwa1:

• d1awwa1 first appeared (with stable ids) in SCOP 1.55, called d1aww__
  
• d1awwa1 was called d1awwa_ in SCOPe 2.07