![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Bruton's tyrosine kinase [50068] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries) |
![]() | Domain d1awwa1: 1aww A:4-67 [24529] Other proteins in same PDB: d1awwa2 |
PDB Entry: 1aww (more details)
SCOPe Domain Sequences for d1awwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awwa1 b.34.2.1 (A:4-67) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} stselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvte aeds
Timeline for d1awwa1: