Lineage for d3az8u_ (3az8 U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551122Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2551123Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2551229Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 2551330Domain d3az8u_: 3az8 U: [245287]
    automated match to d3az9g_
    complexed with cl, gol, peg, po4, s21

Details for d3az8u_

PDB Entry: 3az8 (more details), 3.1 Å

PDB Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS21
PDB Compounds: (U:) Beta-hydroxyacyl-ACP dehydratase

SCOPe Domain Sequences for d3az8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3az8u_ d.38.1.6 (U:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
qiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgi
aklsgvgyvngkvvinisemtfal

SCOPe Domain Coordinates for d3az8u_:

Click to download the PDB-style file with coordinates for d3az8u_.
(The format of our PDB-style files is described here.)

Timeline for d3az8u_: