Lineage for d3az8p_ (3az8 P:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902235Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 1902236Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 1902334Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 1902430Domain d3az8p_: 3az8 P: [245282]
    automated match to d3az9g_
    complexed with cl, gol, peg, po4, s21

Details for d3az8p_

PDB Entry: 3az8 (more details), 3.1 Å

PDB Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS21
PDB Compounds: (P:) Beta-hydroxyacyl-ACP dehydratase

SCOPe Domain Sequences for d3az8p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3az8p_ d.38.1.6 (P:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
iaklsgvgyvngkvvinisemtfal

SCOPe Domain Coordinates for d3az8p_:

Click to download the PDB-style file with coordinates for d3az8p_.
(The format of our PDB-style files is described here.)

Timeline for d3az8p_: