SCOPe 2.06: Domain d1awxa_: 1awx A:

Lineage for d1awxa_ (1awx A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Bruton's tyrosine kinase [50068] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)

8. Domain d1awxa_: 1awx A: [24528]

Details for d1awxa_

PDB Entry: 1awx

PDB Description: sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure

PDB Compounds: (A:) bruton's tyrosine kinase

SCOPe Domain Sequences for d1awxa_:

Sequence; same for both SEQRES and ATOM records:

>d1awxa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
vteaeds

Timeline for d1awxa_:

• d1awxa_ first appeared (with stable ids) in SCOP 1.55, called d1awx__
  
• d1awxa_ appears in SCOPe 2.05
  
• d1awxa_ appears in SCOPe 2.07
  
• d1awxa_ appears in the current release, SCOPe 2.08, called d1awxa1