Lineage for d1awx__ (1awx -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165464Protein Bruton's tyrosine kinase [50068] (1 species)
  7. 165465Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)
  8. 165466Domain d1awx__: 1awx - [24528]

Details for d1awx__

PDB Entry: 1awx (more details)

PDB Description: sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure

SCOP Domain Sequences for d1awx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awx__ b.34.2.1 (-) Bruton's tyrosine kinase {Human (Homo sapiens)}
gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
vteaeds

SCOP Domain Coordinates for d1awx__:

Click to download the PDB-style file with coordinates for d1awx__.
(The format of our PDB-style files is described here.)

Timeline for d1awx__: