Lineage for d1awxa_ (1awx A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377093Protein Bruton's tyrosine kinase [50068] (1 species)
  7. 2377094Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)
  8. 2377096Domain d1awxa_: 1awx A: [24528]

Details for d1awxa_

PDB Entry: 1awx (more details)

PDB Description: sh3 domain from bruton's tyrosine kinase, nmr, minimized average structure
PDB Compounds: (A:) bruton's tyrosine kinase

SCOPe Domain Sequences for d1awxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awxa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
gsmstselkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsny
vteaeds

SCOPe Domain Coordinates for d1awxa_:

Click to download the PDB-style file with coordinates for d1awxa_.
(The format of our PDB-style files is described here.)

Timeline for d1awxa_: