![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
![]() | Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries) Uniprot Q965D7 84-229! Uniprot Q965D7 94-229 |
![]() | Domain d3az8m_: 3az8 M: [245279] automated match to d3az9g_ complexed with cl, gol, peg, po4, s21 |
PDB Entry: 3az8 (more details), 3.1 Å
SCOPe Domain Sequences for d3az8m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3az8m_ d.38.1.6 (M:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg iaklsgvgyvngkvvinisemtfal
Timeline for d3az8m_: