Lineage for d3az8j_ (3az8 J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944056Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2944057Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2944163Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143186] (8 PDB entries)
    Uniprot Q965D7 84-229! Uniprot Q965D7 94-229
  8. 2944253Domain d3az8j_: 3az8 J: [245276]
    automated match to d3az9g_
    complexed with cl, gol, peg, po4, s21

Details for d3az8j_

PDB Entry: 3az8 (more details), 3.1 Å

PDB Description: Beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Plasmodium falciparum in complex with NAS21
PDB Compounds: (J:) Beta-hydroxyacyl-ACP dehydratase

SCOPe Domain Sequences for d3az8j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3az8j_ d.38.1.6 (J:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
lqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanlisfksslg
iaklsgvgyvngkvvinisemtfa

SCOPe Domain Coordinates for d3az8j_:

Click to download the PDB-style file with coordinates for d3az8j_.
(The format of our PDB-style files is described here.)

Timeline for d3az8j_: