Lineage for d1qwfa_ (1qwf A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310107Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 1310108Species Avian sarcoma virus [TaxId:11876] [50067] (2 PDB entries)
    v-src
  8. 1310109Domain d1qwfa_: 1qwf A: [24527]

Details for d1qwfa_

PDB Entry: 1qwf (more details)

PDB Description: c-src sh3 domain complexed with ligand vsl12
PDB Compounds: (A:) Tyrosine-protein kinase transforming protein Src

SCOPe Domain Sequences for d1qwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwfa_ b.34.2.1 (A:) c-src protein tyrosine kinase {Avian sarcoma virus [TaxId: 11876]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1qwfa_:

Click to download the PDB-style file with coordinates for d1qwfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qwfa_: