Lineage for d1qwfa_ (1qwf A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13108Protein c-src tyrosine kinase [50064] (3 species)
  7. 13109Species Avian sarcoma virus [TaxId:11876] [50067] (2 PDB entries)
  8. 13111Domain d1qwfa_: 1qwf A: [24527]

Details for d1qwfa_

PDB Entry: 1qwf (more details)

PDB Description: c-src sh3 domain complexed with ligand vsl12

SCOP Domain Sequences for d1qwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwfa_ b.34.2.1 (A:) c-src tyrosine kinase {Avian sarcoma virus}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOP Domain Coordinates for d1qwfa_:

Click to download the PDB-style file with coordinates for d1qwfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qwfa_: