SCOPe 2.08: Domain d3ay2b_: 3ay2 B:

Lineage for d3ay2b_ (3ay2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)

8. Domain d3ay2b_: 3ay2 B: [245266]
   automated match to d1rkra_
   complexed with gol, so4, zn

Details for d3ay2b_

PDB Entry: 3ay2, 1.9 Å

PDB Description: Crystal structure of Neisserial azurin

PDB Compounds: (B:) Lipid modified azurin protein

SCOPe Domain Sequences for d3ay2b_:

Sequence; same for both SEQRES and ATOM records:

>d3ay2b_ b.6.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
ncaatvesndnmqfntkdiqvskackeftitlkhtgtqpkasmghnlviakaedmdgvfk
dgvgaadtdyvkpddarvvahtkligggeessltldpakladgdykfactfpghgalmng
kvtlvd

Timeline for d3ay2b_:

• d3ay2b_ first appeared in SCOPe 2.04
  
• d3ay2b_ appears in SCOPe 2.07