Lineage for d3ay2b_ (3ay2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772551Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)
  8. 2772553Domain d3ay2b_: 3ay2 B: [245266]
    automated match to d1rkra_
    complexed with gol, so4, zn

Details for d3ay2b_

PDB Entry: 3ay2 (more details), 1.9 Å

PDB Description: Crystal structure of Neisserial azurin
PDB Compounds: (B:) Lipid modified azurin protein

SCOPe Domain Sequences for d3ay2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ay2b_ b.6.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
ncaatvesndnmqfntkdiqvskackeftitlkhtgtqpkasmghnlviakaedmdgvfk
dgvgaadtdyvkpddarvvahtkligggeessltldpakladgdykfactfpghgalmng
kvtlvd

SCOPe Domain Coordinates for d3ay2b_:

Click to download the PDB-style file with coordinates for d3ay2b_.
(The format of our PDB-style files is described here.)

Timeline for d3ay2b_: