SCOPe 2.08: Domain d3axja1: 3axj A:1-221

Lineage for d3axja1 (3axj A:1-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.16: Translin [74784] (2 families)
   automatically mapped to Pfam PF01997

5. Family a.118.16.0: automated matches [254282] (1 protein)
   not a true family

6. Protein automated matches [254661] (1 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255755] (1 PDB entry)

8. Domain d3axja1: 3axj A:1-221 [245264]
   Other proteins in same PDB: d3axja2
   automated match to d1keya_

Details for d3axja1

PDB Entry: 3axj, 2.1 Å

PDB Description: High resolution crystal structure of C3PO

PDB Compounds: (A:) GM27569p

SCOPe Domain Sequences for d3axja1:

Sequence; same for both SEQRES and ATOM records:

>d3axja1 a.118.16.0 (A:1-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msnfvnldifsnyqkyidneqevrenirivvreiehlskeaqiklqiihsdlsqisaacg
larkqvelcaqkyqklaelvpagqyyrysdhwtfitqrlifiialviyleagflvtretv
aemlglkisqsegfhldvedyllgilqlaselsrfatnsvtmgdyerplnishfigdlnt
gfrllnlkndglrkrfdalkydvkkieevvydvsirglssk

Timeline for d3axja1:

• d3axja1 first appeared in SCOPe 2.04, called d3axja_
  
• d3axja1 appears in SCOPe 2.07