![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.16: Translin [74784] (2 families) ![]() automatically mapped to Pfam PF01997 |
![]() | Family a.118.16.0: automated matches [254282] (1 protein) not a true family |
![]() | Protein automated matches [254661] (1 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255755] (1 PDB entry) |
![]() | Domain d3axja1: 3axj A:1-221 [245264] Other proteins in same PDB: d3axja2 automated match to d1keya_ |
PDB Entry: 3axj (more details), 2.1 Å
SCOPe Domain Sequences for d3axja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3axja1 a.118.16.0 (A:1-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} msnfvnldifsnyqkyidneqevrenirivvreiehlskeaqiklqiihsdlsqisaacg larkqvelcaqkyqklaelvpagqyyrysdhwtfitqrlifiialviyleagflvtretv aemlglkisqsegfhldvedyllgilqlaselsrfatnsvtmgdyerplnishfigdlnt gfrllnlkndglrkrfdalkydvkkieevvydvsirglssk
Timeline for d3axja1: