SCOPe 2.07: Domain d3ax0a1: 3ax0 A:2-273

Lineage for d3ax0a1 (3ax0 A:2-273)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.3: Tyrosinase [254185] (1 protein)
   Pfam PF00264

6. Protein Tyrosinase [254409] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)

8. Domain d3ax0a1: 3ax0 A:2-273 [245260]
   Other proteins in same PDB: d3ax0a2, d3ax0b_
   automated match to d2ahka_
   complexed with cu, no3; mutant

Details for d3ax0a1

PDB Entry: 3ax0, 1.4 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie Y98F mutant soaked in a Cu(II)-containing solution for 80 hr

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3ax0a1:

Sequence; same for both SEQRES and ATOM records:

>d3ax0a1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

Timeline for d3ax0a1:

• d3ax0a1 first appeared in SCOPe 2.04, called d3ax0a_
  
• d3ax0a1 appears in SCOPe 2.06
  
• d3ax0a1 appears in the current release, SCOPe 2.08