Lineage for d1qwea_ (1qwe A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782953Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2782954Species Avian sarcoma virus [TaxId:11876] [50067] (2 PDB entries)
    v-src
  8. 2782956Domain d1qwea_: 1qwe A: [24526]

Details for d1qwea_

PDB Entry: 1qwe (more details)

PDB Description: c-src sh3 domain complexed with ligand app12
PDB Compounds: (A:) Tyrosine-protein kinase transforming protein Src

SCOPe Domain Sequences for d1qwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qwea_ b.34.2.1 (A:) c-src protein tyrosine kinase {Avian sarcoma virus [TaxId: 11876]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1qwea_:

Click to download the PDB-style file with coordinates for d1qwea_.
(The format of our PDB-style files is described here.)

Timeline for d1qwea_: