![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein c-src protein tyrosine kinase [50064] (3 species) |
![]() | Species Avian sarcoma virus [TaxId:11876] [50067] (2 PDB entries) v-src |
![]() | Domain d1qwea_: 1qwe A: [24526] |
PDB Entry: 1qwe (more details)
SCOPe Domain Sequences for d1qwea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qwea_ b.34.2.1 (A:) c-src protein tyrosine kinase {Avian sarcoma virus [TaxId: 11876]} tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
Timeline for d1qwea_: