![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
![]() | Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) ![]() duplication: contains two structural repeats |
![]() | Family a.86.1.3: Tyrosinase [254185] (1 protein) Pfam PF00264 |
![]() | Protein Tyrosinase [254409] (1 species) |
![]() | Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries) |
![]() | Domain d3awza1: 3awz A:2-273 [245258] Other proteins in same PDB: d3awza2, d3awzb_ automated match to d2ahka_ complexed with cu, no3; mutant |
PDB Entry: 3awz (more details), 1.43 Å
SCOPe Domain Sequences for d3awza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3awza1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]} tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt pdvvdlnetmkpwntvrpadlldhtayytfda
Timeline for d3awza1: