| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily) 2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386 |
Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families) ![]() Pfam PF06236 |
| Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins) |
| Protein Tyrosinase cofactor MelC1 [254410] (1 species) |
| Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries) |
| Domain d3awxb_: 3awx B: [245255] Other proteins in same PDB: d3awxa1, d3awxa2 automated match to d2ahkb_ complexed with cu, no3; mutant |
PDB Entry: 3awx (more details), 1.25 Å
SCOPe Domain Sequences for d3awxb_:
Sequence, based on SEQRES records: (download)
>d3awxb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlqvmrnadgswisvvshyd
pvptpraaaraavdelqgapllp
>d3awxb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagyevfvdgvqlqvmrnadgswisvvshydpvptpraaara
avdelqgapllp
Timeline for d3awxb_: