SCOPe 2.05: Domain d3awwa_: 3aww A:

Lineage for d3awwa_ (3aww A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.3: Tyrosinase [254185] (1 protein)
   Pfam PF00264

6. Protein Tyrosinase [254409] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (22 PDB entries)

8. Domain d3awwa_: 3aww A: [245252]
   Other proteins in same PDB: d3awwb_
   automated match to d2ahka_
   complexed with cu, no3

Details for d3awwa_

PDB Entry: 3aww, 1.35 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie soaked in a Cu(II)-containing solution for 80 hr: occupancy of CuA is high

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3awwa_:

Sequence; same for both SEQRES and ATOM records:

>d3awwa_ a.86.1.3 (A:) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfdalehhhh

Timeline for d3awwa_:

• d3awwa_ first appeared in SCOPe 2.04
  
• d3awwa_ is called d3awwa1 in SCOPe 2.06
  
• d3awwa_ appears in the current release, SCOPe 2.08, called d3awwa1