SCOPe 2.05: Domain d3awvb_: 3awv B:

Lineage for d3awvb_ (3awv B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (1 family)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (1 protein)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (22 PDB entries)

8. Domain d3awvb_: 3awv B: [245251]
   Other proteins in same PDB: d3awva_
   automated match to d2ahkb_
   complexed with cu, no3

Details for d3awvb_

PDB Entry: 3awv, 1.4 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie soaked in a Cu(II)-containing solution for 80 hr: occupancy of CuA is low

PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d3awvb_:

Sequence, based on SEQRES records:

>d3awvb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records):

>d3awvb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshydpvptpr
aaaraavdelqgapllpf

Timeline for d3awvb_:

• d3awvb_ first appeared in SCOPe 2.04
  
• d3awvb_ appears in SCOPe 2.06
  
• d3awvb_ appears in the current release, SCOPe 2.08