Lineage for d3awva1 (3awv A:2-273)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332526Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2332527Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2332567Family a.86.1.3: Tyrosinase [254185] (1 protein)
    Pfam PF00264
  6. 2332568Protein Tyrosinase [254409] (1 species)
  7. 2332569Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)
  8. 2332582Domain d3awva1: 3awv A:2-273 [245250]
    Other proteins in same PDB: d3awva2, d3awvb_
    automated match to d2ahka_
    complexed with cu, no3

Details for d3awva1

PDB Entry: 3awv (more details), 1.4 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie soaked in a Cu(II)-containing solution for 80 hr: occupancy of CuA is low
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3awva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3awva1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

SCOPe Domain Coordinates for d3awva1:

Click to download the PDB-style file with coordinates for d3awva1.
(The format of our PDB-style files is described here.)

Timeline for d3awva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3awva2
View in 3D
Domains from other chains:
(mouse over for more information)
d3awvb_