Lineage for d1srla_ (1srl A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310107Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 1310111Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 1310116Domain d1srla_: 1srl A: [24525]

Details for d1srla_

PDB Entry: 1srl (more details)

PDB Description: 1h and 15n assignments and secondary structure of the src sh3 domain
PDB Compounds: (A:) src tyrosine kinase sh3 domain

SCOPe Domain Sequences for d1srla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srla_ b.34.2.1 (A:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1srla_:

Click to download the PDB-style file with coordinates for d1srla_.
(The format of our PDB-style files is described here.)

Timeline for d1srla_: