SCOPe 2.08: Domain d3awta1: 3awt A:2-273

Lineage for d3awta1 (3awt A:2-273)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.3: Tyrosinase [254185] (1 protein)
   Pfam PF00264

6. Protein Tyrosinase [254409] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)

8. Domain d3awta1: 3awt A:2-273 [245246]
   Other proteins in same PDB: d3awta2, d3awtb_
   automated match to d2ahka_
   complexed with cu, no3

Details for d3awta1

PDB Entry: 3awt, 1.35 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie soaked in a Cu(II)-containing solution for 20 hr: occupancy of Cu(II) is high

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3awta1:

Sequence; same for both SEQRES and ATOM records:

>d3awta1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

Timeline for d3awta1:

• d3awta1 first appeared in SCOPe 2.04, called d3awta_
  
• d3awta1 appears in SCOPe 2.07