Lineage for d3avqa_ (3avq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850183Species Mycobacterium tuberculosis [TaxId:83332] [187746] (21 PDB entries)
  8. 1850212Domain d3avqa_: 3avq A: [245243]
    automated match to d2gesa_
    complexed with flc, gol, mv1

Details for d3avqa_

PDB Entry: 3avq (more details), 3 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with N9-Pan
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d3avqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3avqa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d3avqa_:

Click to download the PDB-style file with coordinates for d3avqa_.
(The format of our PDB-style files is described here.)

Timeline for d3avqa_: