Lineage for d3atpb_ (3atp B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699469Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) (S)
    automatically mapped to Pfam PF02203
  5. 2699485Family a.24.2.0: automated matches [254222] (1 protein)
    not a true family
  6. 2699486Protein automated matches [254505] (3 species)
    not a true protein
  7. 2699487Species Escherichia coli [TaxId:316407] [255753] (1 PDB entry)
  8. 2699489Domain d3atpb_: 3atp B: [245230]
    automated match to d2asra_
    complexed with ser

Details for d3atpb_

PDB Entry: 3atp (more details), 2.5 Å

PDB Description: Structure of the ligand binding domain of the bacterial serine chemoreceptor Tsr with ligand
PDB Compounds: (B:) methyl-accepting chemotaxis protein I

SCOPe Domain Sequences for d3atpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atpb_ a.24.2.0 (B:) automated matches {Escherichia coli [TaxId: 316407]}
enftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvaelmesasis
lkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkineffdqptq
gyqdgfekqyvaymeqndrlhdiavsdnnas

SCOPe Domain Coordinates for d3atpb_:

Click to download the PDB-style file with coordinates for d3atpb_.
(The format of our PDB-style files is described here.)

Timeline for d3atpb_: