SCOPe 2.08: Domain d3atpa_: 3atp A:

Lineage for d3atpa_ (3atp A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families)
   automatically mapped to Pfam PF02203

5. Family a.24.2.0: automated matches [254222] (1 protein)
   not a true family

6. Protein automated matches [254505] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:316407] [255753] (1 PDB entry)

8. Domain d3atpa_: 3atp A: [245229]
   automated match to d2asra_
   complexed with ser

Details for d3atpa_

PDB Entry: 3atp, 2.5 Å

PDB Description: Structure of the ligand binding domain of the bacterial serine chemoreceptor Tsr with ligand

PDB Compounds: (A:) methyl-accepting chemotaxis protein I

SCOPe Domain Sequences for d3atpa_:

Sequence; same for both SEQRES and ATOM records:

>d3atpa_ a.24.2.0 (A:) automated matches {Escherichia coli [TaxId: 316407]}
nftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvaelmesasisl
kqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkineffdqptqg
yqdgfekqyvaymeqndrlhdiavsdnnasy

Timeline for d3atpa_:

• d3atpa_ first appeared in SCOPe 2.04
  
• d3atpa_ appears in SCOPe 2.07