SCOPe 2.06: Domain d3atda_: 3atd A:

Lineage for d3atda_ (3atd A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (9 PDB entries)

8. Domain d3atda_: 3atd A: [245228]
   automated match to d2e4fa_
   complexed with gd

Details for d3atda_

PDB Entry: 3atd, 3.01 Å

PDB Description: crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride and 10 mm magnesium chloride)

PDB Compounds: (A:) Potassium inwardly-rectifying channel, subfamily J, member 6

SCOPe Domain Sequences for d3atda_:

Sequence, based on SEQRES records:

>d3atda_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnshiveasi
raklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaql
pkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhet
yetstpslsakelaelanr

Sequence, based on observed residues (ATOM records):

>d3atda_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqryvrkdgkcnvhhgnvraetlvfsthavismrdgklclmfrvgdlrnshiveasirak
likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke
eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet
stpslsakelaelanr

Timeline for d3atda_:

• d3atda_ first appeared in SCOPe 2.04
  
• d3atda_ appears in SCOPe 2.05
  
• d3atda_ appears in SCOPe 2.07
  
• d3atda_ appears in the current release, SCOPe 2.08