![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
![]() | Protein automated matches [190782] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries) |
![]() | Domain d3atda_: 3atd A: [245228] automated match to d2e4fa_ complexed with gd |
PDB Entry: 3atd (more details), 3.01 Å
SCOPe Domain Sequences for d3atda_:
Sequence, based on SEQRES records: (download)
>d3atda_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnshiveasi raklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaql pkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhet yetstpslsakelaelanr
>d3atda_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqryvrkdgkcnvhhgnvraetlvfsthavismrdgklclmfrvgdlrnshiveasirak likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet stpslsakelaelanr
Timeline for d3atda_: