Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries) |
Domain d1srma_: 1srm A: [24522] |
PDB Entry: 1srm (more details)
SCOPe Domain Sequences for d1srma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1srma_ b.34.2.1 (A:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
Timeline for d1srma_: