Lineage for d3asnq_ (3asn Q:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024793Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 3024794Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 3024854Protein automated matches [190270] (1 species)
    not a true protein
  7. 3024855Species Cow (Bos taurus) [TaxId:9913] [187062] (26 PDB entries)
  8. 3024900Domain d3asnq_: 3asn Q: [245218]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnc_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnp_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d1v54d_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnq_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d3asnq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d3asnq_:

Click to download the PDB-style file with coordinates for d3asnq_.
(The format of our PDB-style files is described here.)

Timeline for d3asnq_: