Lineage for d3asnp_ (3asn P:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698889Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1698890Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 1698891Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1698904Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1698905Species Cow (Bos taurus) [TaxId:9913] [81444] (26 PDB entries)
  8. 1698947Domain d3asnp_: 3asn P: [245217]
    Other proteins in same PDB: d3asna_, d3asnb1, d3asnb2, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno1, d3asno2, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d2occc_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnp_

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d3asnp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asnp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d3asnp_:

Click to download the PDB-style file with coordinates for d3asnp_.
(The format of our PDB-style files is described here.)

Timeline for d3asnp_: