SCOPe 2.07: Domain d3asnn_: 3asn N:

Lineage for d3asnn_ (3asn N:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
   12 transmembrane helices in an approximate threefold rotational symmetric arrangement

4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family)

5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
   the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3

6. Protein automated matches [190134] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries)

8. Domain d3asnn_: 3asn N: [245214]
   Other proteins in same PDB: d3asnb1, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asno1, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
   automated match to d1v54a_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asnn_

PDB Entry: 3asn, 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength

PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3asnn_:

Sequence; same for both SEQRES and ATOM records:

>d3asnn_ f.24.1.1 (N:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

Timeline for d3asnn_:

• d3asnn_ first appeared in SCOPe 2.04
  
• d3asnn_ appears in SCOPe 2.06
  
• d3asnn_ appears in the current release, SCOPe 2.08