SCOPe 2.08: Domain d3argc2: 3arg C:118-207

Lineage for d3argc2 (3arg C:118-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3argc2: 3arg C:118-207 [245197]
   Other proteins in same PDB: d3argb_, d3argc1, d3argd1, d3argd2
   automated match to d4eura2
   complexed with db6, nag

Details for d3argc2

PDB Entry: 3arg, 3 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-alpha- glucosylceramide(c20:2)

PDB Compounds: (C:) NKT Valpha14-Jalpha18,NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3argc2:

Sequence, based on SEQRES records:

>d3argc2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d3argc2 b.1.1.2 (C:118-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffpsp

Timeline for d3argc2:

• d3argc2 first appeared in SCOPe 2.04
  
• d3argc2 appears in SCOPe 2.07