Lineage for d3argc1 (3arg C:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371219Domain d3argc1: 3arg C:1-117 [245196]
    Other proteins in same PDB: d3argb_, d3argc2
    automated match to d4eura1
    complexed with db6, nag

Details for d3argc1

PDB Entry: 3arg (more details), 3 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-alpha- glucosylceramide(c20:2)
PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3argc1:

Sequence, based on SEQRES records: (download)

>d3argc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Sequence, based on observed residues (ATOM records): (download)

>d3argc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsagrlhfgagtqlivipd

SCOPe Domain Coordinates for d3argc1:

Click to download the PDB-style file with coordinates for d3argc1.
(The format of our PDB-style files is described here.)

Timeline for d3argc1: