SCOPe 2.07: Domain d3argc1: 3arg C:1-117

Lineage for d3argc1 (3arg C:1-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3argc1: 3arg C:1-117 [245196]
   Other proteins in same PDB: d3argb_, d3argc2
   automated match to d4eura1
   complexed with db6, nag

Details for d3argc1

PDB Entry: 3arg, 3 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-alpha- glucosylceramide(c20:2)

PDB Compounds: (C:) NKT Valpha14-Jalpha18

SCOPe Domain Sequences for d3argc1:

Sequence, based on SEQRES records:

>d3argc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Sequence, based on observed residues (ATOM records):

>d3argc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsagrlhfgagtqlivipd

Timeline for d3argc1:

• d3argc1 first appeared in SCOPe 2.04
  
• d3argc1 appears in SCOPe 2.06
  
• d3argc1 appears in the current release, SCOPe 2.08