SCOPe 2.05: Domain d3ardd2: 3ard D:119-247

Lineage for d3ardd2 (3ard D:119-247)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3ardd2: 3ard D:119-247 [245194]
   Other proteins in same PDB: d3ardb_, d3ardc2
   automated match to d2nw2b2
   complexed with 3gh

Details for d3ardd2

PDB Entry: 3ard, 3.01 Å

PDB Description: ternary crystal structure of the mouse nkt tcr-cd1d-3'deoxy-alpha- galactosylceramide

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3ardd2:

Sequence; same for both SEQRES and ATOM records:

>d3ardd2 b.1.1.0 (D:119-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3ardd2:

• d3ardd2 first appeared in SCOPe 2.04
  
• d3ardd2 appears in SCOPe 2.06
  
• d3ardd2 appears in the current release, SCOPe 2.08