| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (19 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
| Domain d3ardc1: 3ard C:1-117 [245191] Other proteins in same PDB: d3ardb_, d3ardc2 automated match to d4eura1 complexed with 3gh |
PDB Entry: 3ard (more details), 3.01 Å
SCOPe Domain Sequences for d3ardc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ardc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d3ardc1: