Lineage for d1nloc_ (1nlo C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120720Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 1120724Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 1120726Domain d1nloc_: 1nlo C: [24519]

Details for d1nloc_

PDB Entry: 1nlo (more details)

PDB Description: structure of signal transduction protein, nmr, minimized average structure
PDB Compounds: (C:) c-src

SCOPe Domain Sequences for d1nloc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nloc_ b.34.2.1 (C:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1nloc_:

Click to download the PDB-style file with coordinates for d1nloc_.
(The format of our PDB-style files is described here.)

Timeline for d1nloc_: