Lineage for d1nloc_ (1nlo C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58334Protein c-src tyrosine kinase [50064] (3 species)
  7. 58338Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 58340Domain d1nloc_: 1nlo C: [24519]

Details for d1nloc_

PDB Entry: 1nlo (more details)

PDB Description: structure of signal transduction protein, nmr, minimized average structure

SCOP Domain Sequences for d1nloc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nloc_ b.34.2.1 (C:) c-src tyrosine kinase {Chicken (Gallus gallus)}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOP Domain Coordinates for d1nloc_:

Click to download the PDB-style file with coordinates for d1nloc_.
(The format of our PDB-style files is described here.)

Timeline for d1nloc_: