SCOPe 2.08: Domain d3apma1: 3apm A:2-112

Lineage for d3apma1 (3apm A:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein)
   probably related to cupredoxins but lacking the metal-binding site
   automatically mapped to Pfam PF08526

6. Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110109] (16 PDB entries)
   Uniprot Q9UM07

8. Domain d3apma1: 3apm A:2-112 [245184]
   Other proteins in same PDB: d3apma2, d3apma3
   automated match to d2dexx2

Details for d3apma1

PDB Entry: 3apm, 2.5 Å

PDB Description: Crystal structure of the human SNP PAD4 protein

PDB Compounds: (A:) Protein-arginine deiminase type-4

SCOPe Domain Sequences for d3apma1:

Sequence, based on SEQRES records:

>d3apma1 b.6.1.6 (A:2-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aqgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahgppakkk
stgsstwpldpgvevtltmkvasgstgdqkvqisyygpktppvkallyltg

Sequence, based on observed residues (ATOM records):

>d3apma1 b.6.1.6 (A:2-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
aqgtlirvtpeqpthavcvlgtltqldicsssfsinaspgvvvdiahstwpldpgvevtl
tmkvasgstgdqkvqisyygpktppvkallyltg

Timeline for d3apma1:

• d3apma1 first appeared in SCOPe 2.04
  
• d3apma1 appears in SCOPe 2.07