Lineage for d1rlpc_ (1rlp C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796230Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 796234Species Chicken (Gallus gallus) [TaxId:9031] [50066] (9 PDB entries)
  8. 796240Domain d1rlpc_: 1rlp C: [24518]

Details for d1rlpc_

PDB Entry: 1rlp (more details)

PDB Description: two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
PDB Compounds: (C:) c-src tyrosine kinase sh3 domain

SCOP Domain Sequences for d1rlpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlpc_ b.34.2.1 (C:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOP Domain Coordinates for d1rlpc_:

Click to download the PDB-style file with coordinates for d1rlpc_.
(The format of our PDB-style files is described here.)

Timeline for d1rlpc_: