| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein c-src protein tyrosine kinase [50064] (3 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries) |
| Domain d1rlpc_: 1rlp C: [24518] |
PDB Entry: 1rlp (more details)
SCOPe Domain Sequences for d1rlpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlpc_ b.34.2.1 (C:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
Timeline for d1rlpc_: