![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
![]() | Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries) |
![]() | Domain d3apca3: 3apc A:546-725 [245174] Other proteins in same PDB: d3apca1, d3apca2, d3apca4 automated match to d1e7ua1 complexed with mmd, so4 |
PDB Entry: 3apc (more details), 2.54 Å
SCOPe Domain Sequences for d3apca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3apca3 a.118.1.6 (A:546-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg
Timeline for d3apca3: