Lineage for d2ptka1 (2ptk A:83-145)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392578Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2392582Species Chicken (Gallus gallus) [TaxId:9031] [50066] (10 PDB entries)
  8. 2392584Domain d2ptka1: 2ptk A:83-145 [24517]
    Other proteins in same PDB: d2ptka2, d2ptka3

Details for d2ptka1

PDB Entry: 2ptk (more details), 2.35 Å

PDB Description: chicken src tyrosine kinase
PDB Compounds: (A:) Tyrosine-protein kinase transforming protein Src

SCOPe Domain Sequences for d2ptka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptka1 b.34.2.1 (A:83-145) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
iqa

SCOPe Domain Coordinates for d2ptka1:

Click to download the PDB-style file with coordinates for d2ptka1.
(The format of our PDB-style files is described here.)

Timeline for d2ptka1: