SCOPe 2.07: Domain d2ptka1: 2ptk A:83-145

Lineage for d2ptka1 (2ptk A:83-145)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein c-src protein tyrosine kinase [50064] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50066] (10 PDB entries)

8. Domain d2ptka1: 2ptk A:83-145 [24517]
   Other proteins in same PDB: d2ptka2, d2ptka3

Details for d2ptka1

PDB Entry: 2ptk, 2.35 Å

PDB Description: chicken src tyrosine kinase

PDB Compounds: (A:) Tyrosine-protein kinase transforming protein Src

SCOPe Domain Sequences for d2ptka1:

Sequence; same for both SEQRES and ATOM records:

>d2ptka1 b.34.2.1 (A:83-145) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
vttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsds
iqa

Timeline for d2ptka1:

• d2ptka1 first appeared (with stable ids) in SCOP 1.55, called d2ptk_1
  
• d2ptka1 appears in SCOPe 2.06
  
• d2ptka1 appears in the current release, SCOPe 2.08