Lineage for d3alqf_ (3alq F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041369Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041370Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2041371Family b.22.1.1: TNF-like [49843] (15 protein domains)
  6. 2041568Protein Tumor necrosis factor (TNF) [49848] (2 species)
  7. 2041569Species Human (Homo sapiens) [TaxId:9606] [49849] (19 PDB entries)
  8. 2041601Domain d3alqf_: 3alq F: [245165]
    automated match to d1a8ma_
    complexed with co

Details for d3alqf_

PDB Entry: 3alq (more details), 3 Å

PDB Description: Crystal structure of TNF-TNFR2 complex
PDB Compounds: (F:) Tumor necrosis factor

SCOPe Domain Sequences for d3alqf_:

Sequence, based on SEQRES records: (download)

>d3alqf_ b.22.1.1 (F:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
cpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiylggvfqlep
gdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records): (download)

>d3alqf_ b.22.1.1 (F:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
nrpdyldfaesgqvyfgiial

SCOPe Domain Coordinates for d3alqf_:

Click to download the PDB-style file with coordinates for d3alqf_.
(The format of our PDB-style files is described here.)

Timeline for d3alqf_: