SCOPe 2.04: Domain d3alqc_: 3alq C:

Lineage for d3alqc_ (3alq C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Tumor necrosis factor (TNF) [49848] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49849] (13 PDB entries)

8. Domain d3alqc_: 3alq C: [245162]
   automated match to d1a8ma_
   complexed with co

Details for d3alqc_

PDB Entry: 3alq, 3 Å

PDB Description: Crystal structure of TNF-TNFR2 complex

PDB Compounds: (C:) Tumor necrosis factor

SCOPe Domain Sequences for d3alqc_:

Sequence, based on SEQRES records:

>d3alqc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
cpsthvllthtisriavsyqtpvnllsairspcqretpegaeanpwyepiylggvfqlep
gdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records):

>d3alqc_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]}
sdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgqg
cpsthvllthtisriavsyqtpvnllsairspcqanpwyepiylggvfqlepgdrlsaei
nrpdyldfaesgqvyfgiial

Timeline for d3alqc_:

• d3alqc_ is new in SCOPe 2.04-stable
  
• d3alqc_ appears in SCOPe 2.05
  
• d3alqc_ appears in the current release, SCOPe 2.08