![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Carboxyl-terminal src kinase (csk) [74654] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries) |
![]() | Domain d1cskd_: 1csk D: [24516] |
PDB Entry: 1csk (more details), 2.5 Å
SCOPe Domain Sequences for d1cskd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cskd_ b.34.2.1 (D:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr
Timeline for d1cskd_: