Lineage for d1cskd_ (1csk D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782984Protein Carboxyl-terminal src kinase (csk) [74654] (2 species)
  7. 2782985Species Human (Homo sapiens) [TaxId:9606] [74658] (2 PDB entries)
  8. 2782989Domain d1cskd_: 1csk D: [24516]

Details for d1cskd_

PDB Entry: 1csk (more details), 2.5 Å

PDB Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop
PDB Compounds: (D:) c-src sh3 domain

SCOPe Domain Sequences for d1cskd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cskd_ b.34.2.1 (D:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr

SCOPe Domain Coordinates for d1cskd_:

Click to download the PDB-style file with coordinates for d1cskd_.
(The format of our PDB-style files is described here.)

Timeline for d1cskd_: