SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ajrb_ (3ajr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2096069Species Thermoplasma volcanium [TaxId:273116] [194922] (2 PDB entries)
  8. 2096071Domain d3ajrb_: 3ajr B: [245159]
    automated match to d2p4hx_
    complexed with mpd, nad, vah

Details for d3ajrb_

PDB Entry: 3ajr (more details), 1.77 Å

PDB Description: Crystal structure of L-3-Hydroxynorvaline bound L-Threonine dehydrogenase (Y137F) from Hyperthermophilic Archaeon Thermoplasma volcanium
PDB Compounds: (B:) NDP-sugar epimerase

SCOPe Domain Sequences for d3ajrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ajrb_ c.2.1.0 (B:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
pknkvpsititrprtmfgvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
midhisek

SCOPe Domain Coordinates for d3ajrb_:

Click to download the PDB-style file with coordinates for d3ajrb_.
(The format of our PDB-style files is described here.)

Timeline for d3ajrb_: