Lineage for d3aiva_ (3aiv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083092Species Secale cereale [TaxId:4550] [255749] (3 PDB entries)
  8. 2083095Domain d3aiva_: 3aiv A: [245156]
    automated match to d1v08a_
    complexed with hbo

Details for d3aiva_

PDB Entry: 3aiv (more details), 2.5 Å

PDB Description: Crystal structure of beta-glucosidase in rye complexed with an aglycone DIMBOA
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3aiva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aiva_ c.1.8.4 (A:) automated matches {Secale cereale [TaxId: 4550]}
vftklkpwqipkrdwfskdflfgastsayqiegawnedgkgpstwdhfchtyperisdgt
ngdvaansyhmyeedvkalkdmgmkvyrfsiswsrilpngtgkpnqkgidyynnlinsli
rhgivpyvtiwhwdtpqaledkyggfldkqivndykyfaelcfqsfgdrvknwftfneph
tyccfsygegihapgrcspgldcavpegdslrepytaghhillahaeavelfkahynkhg
dskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpm
ftkeeqeklasscdimglnyytsrfskhvdissdytptlntddayassettgsdgneigp
itgtywiymypkgltdlllimkekygnppifitengiadvegdpempdplddwkrldylq
rhisavkdaidqgadvrghftwglidnfewgsgyssrfglvyidkedgnkrklkksakwf
akfnsv

SCOPe Domain Coordinates for d3aiva_:

Click to download the PDB-style file with coordinates for d3aiva_.
(The format of our PDB-style files is described here.)

Timeline for d3aiva_: