Lineage for d3aisa_ (3ais A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083160Species Wheat (Triticum aestivum) [TaxId:4565] [255115] (4 PDB entries)
  8. 2083164Domain d3aisa_: 3ais A: [245154]
    automated match to d1v08a_
    complexed with bgc, hbk; mutant

Details for d3aisa_

PDB Entry: 3ais (more details), 2.2 Å

PDB Description: Crystal structure of a mutant beta-glucosidase in wheat complexed with DIMBOA-Glc
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3aisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aisa_ c.1.8.4 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
gpvftklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisd
mtngdvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklins
lidndivpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfna
phtyccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynm
hgdskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrl
pmftkeeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndi
gpitgtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldy
lqrhisavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksak
wfskfnsvpkp

SCOPe Domain Coordinates for d3aisa_:

Click to download the PDB-style file with coordinates for d3aisa_.
(The format of our PDB-style files is described here.)

Timeline for d3aisa_: