![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
![]() | Protein automated matches [190245] (12 species) not a true protein |
![]() | Species Wheat (Triticum aestivum) [TaxId:4565] [255115] (4 PDB entries) |
![]() | Domain d3aiqa_: 3aiq A: [245152] automated match to d1v08a_ complexed with hbo |
PDB Entry: 3aiq (more details), 1.9 Å
SCOPe Domain Sequences for d3aiqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aiqa_ c.1.8.4 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]} gpvftklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisd mtngdvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklins lidndivpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfne phtyccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynm hgdskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrl pmftkeeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndi gpitgtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldy lqrhisavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksak wfskfnsvpkp
Timeline for d3aiqa_: